• Sonuç bulunamadı

Sonlu elemanlar yöntemi ile modifiye edilmiş eşit genişlikli dalga denkleminin sayısal çözümleri

N/A
N/A
Protected

Academic year: 2021

Share "Sonlu elemanlar yöntemi ile modifiye edilmiş eşit genişlikli dalga denkleminin sayısal çözümleri"

Copied!
248
0
0

Yükleniyor.... (view fulltext now)

Tam metin

(1)

NÖNÜ ÜNVERSTES

FENBLMLER ENSTTÜSÜ

SONLU ELEMANLAR YÖNTEM LE

MODFYE EDLM“ E“T GEN“LKL DALGA DENKLEMNN

SAYISAL ÇÖZÜMLER

Seydi BattalGazi KARAKOÇ

DOKTORA TEZ

MATEMATKANABLM DALI

MALATYA

(2)

GRADUATE SCHOOL OF NATURAL AND APPLIED SCIENCES

NUMERICAL SOLUTIONS OF MODIFIED EQUALWIDTH WAVE

EQUATION WITH FINITE ELEMENTS METHOD

Seydi BattalGazi KARAKOÇ

Ph. D. Thesis

MATHEMATICS DEPARTMENT

MALATYA

(3)

Dalga DenklemininSaysal Çözümleri

Tezi Hazrlayan : Seydi BattalGazi KARAKOÇ

Snav Tarihi : 23.12.2011

Yukardaadgeçentezjürimiz ede§erlendirilerekMatematikAnabilimDal'nda

Doktora Teziolarak kabul edilmi³tir.

Snav Jüri Üyeleri(lk isimjüriba³kan, ikin i isimtez dan³man)

Prof. Dr. dris DA‡ ...

Yrd. Doç. Dr. Turabi GEYKL ...

Prof. Dr. Bilal ALTAY ...

Doç. Dr. Alaattin ESEN ...

Yrd. Doç. Dr. Dursun IRK ...

Yrd. Doç. Dr. Turabi GEYKL

Tez Dan³man

nönü Üniversitesi Fen BilimleriEnstitüsü Onay

Prof. Dr. AsmKÜNKÜL

(4)

Doktora Tezi olarak sundu§um Sonlu Elemanlar Yöntemi ile Modiye

Edilmi³E³itGeni³likliDalgaDenklemininSaysalÇözümleriba³lklbuçal³mann

bilimsel ahlak ve geleneklere aykr dü³e ek bir yardma ba³vurmakszn

tarafm-dan yazld§n ve yararland§m bütün kaynaklarn, hem metin içinde hem de

kay-nakçada yöntemine uygun biçimde gösterilenlerden olu³tu§unu belirtir, bunu

onurumla do§rularm.

(5)

Doktora Tezi

SONLU ELEMANLAR YÖNTEM LE

MODFYE EDLM“ E“T GEN“LKL DALGA DENKLEMNN

SAYISAL ÇÖZÜMLER

Seydi BattalGazi KARAKOÇ

nönü Üniversitesi

Fen BilimleriEnstitüsü

Matematik Anabilim Dal

219+xxv sayfa

2011

Dan³man: Yrd. Doç. Dr. Turabi GEYKL

Bu doktora tezi be³ bölümden olu³maktadr. Birin i bölümde sonlu fark,

varyasyonel, a§rlkl kalan ve sonlu elemanlargibi saysal yöntemler ile ilgiligenel

bilgilerverildiktensonrasplineveB-splinebazfonksiyonlarhakkndatemel

kavram-lar verildi. Ayr a, tez boyun a saysal çözümleri ara³trlanModiedEqual Width

wave (MEW) denklemi ve model problemler tantld.

kin i, üçün ü, dördün ü ve be³in i bölümler bu tezin orijinal ksmlarn

olu³turmaktadr. kin i bölümde, MEW denkleminin saysal çözümleri, kuadratik

ve kübik B-spline fonksiyonlar kullanlarak Galerkin sonlu eleman yöntemi ile elde

edildi. Bu yöntem Bölüm 1'de verilen iki model probleme uyguland. Elde edilen

saysal sonuçlar literatürdeki mev ut sonuçlar ile kar³la³trlarak

I

1

, I

2

ve

I

3

ile gösterilen korunum sabitleri ile

L

2

ve

L

hata normlartablolar halindeverildi.

(6)

rak Petrov-Galerkin sonlu eleman yöntemi ile MEW denkleminin saysal çözümleri

elde edildi. Bu yöntem Bölüm 1'de verilen iki model probleme uyguland. Elde

edilen saysal sonuçlar literatürdeki mev ut sonuçlar ile kar³la³trlarak korunum

sabitleri ilehata normlartablolar halindeverildi.

Dördün übölümde;kuartikvesektikB-splinefonksiyonlarkullanlarak

Sub-domain sonlu eleman yöntemi ile MEW denkleminin saysal çözümleri elde edildi.

Bu yöntem Bölüm 1'de verilen iki model probleme uyguland. Elde edilen saysal

sonuçlar literatürdekimev utsonuçlarilekar³la³trlarakkorunumsabitleriilehata

normlar tablolarhalindeverildi.

Be³in ibölümde;kübik,kuintikveseptikB-spline fonksiyonlar kullanlarak

Kollokasyon sonlu eleman yöntemi ile MEW denkleminin saysal çözümleri elde

edildi. Bu yöntem Bölüm 1'de verilen üç model probleme uyguland. Elde edilen

saysalsonuçlar literatürdeki mev ut sonuçlar ilekar³la³trlarakkorunum sabitleri

ile hata normlar tablolar halinde verildi. MEW denkleminin saysal çözümlerini

elde etmek içinkullanlanbütün yöntemler içinkararllkanaliziyapld.

ANAHTAR KELMELER: Modied Equal Width Wave Denklemi, Sonlu

Ele-manlar Yöntemi, B-Spline Fonksiyonlar, Galerkin Yöntemi, Petrov-Galerkin

(7)

Ph.D.Thesis

NUMERICAL SOLUTIONS OF MODIFIED EQUALWIDTH WAVE

EQUATION WITH FINITE ELEMENTS METHOD

Seydi BattalGazi KARAKOÇ

nönü University

Graduate S hool of Natural and AppliedS ien es

Department of Mathemati s

219+xxvpages

2011

Supervisor: Yrd. Doç. Dr. Turabi GEYKL

This Ph.D. thesis onsistsof ve hapters. In the rst hapter, aftergiving

general information about the numeri al methods su h as nite dieren e,

varia-tonal, weighted residual and nite elements method, fundamental on epts about

splineandB-splinebasisfun tionsaregiven. Moreover,ModiedEqualWidthWave

(MEW)equation andmodel problems ofwhi hsolutionsare soughtthroughoutthe

thesis are introdu ed.

The se ond, third, fourth and fth hapters onstitute the orijinal parts

of this thesis. In the se ond hapter, numeri al solutions of the MEW equation

are obtained by Galerkin nite element method with quadrati and ubi B-spline

(8)

the invariantsdenoted by

I

1

, I

2

and

I

3

and the error norms

L

2

and

L

are given in the formof tables.

Inthethird hapter,numeri alsolutionsoftheMEWequationareobtained

by Petrov-Galerkin nite element methodwith linear,quadrati and ubi B-spline

fun tions. This method is applied totwo model problems given inChapter 1. The

obtained numeri al results are ompared with existing results in the literature and

the invariantsand the error normsare given in the form of tables.

In the fourth hapter, numeri al solutions of the MEW equation are

ob-tained by Subdomain nite element methodwith quarti and sexti B-spline

fun -tions. This method is applied to two model problems given in Chapter 1. The

obtained numeri al results are ompared with existing results in the literature and

the invariantsand the error normsare given in the form of tables.

In the fth hapter, numeri al solutions of the MEW equation are

ob-tained by Collo ationnite elementmethodwith ubi ,quinti andsepti B-spline

fun tions. Thismethodisappliedtothreemodel problemsgiveninChapter 1. The

obtained numeri al results are ompared with existing results in the literature and

the invariantsandthe errornormsare given intheformoftables. Stabilityanalysis

has been made for all the methods used to obtain the numeri al solutions of the

MEW equation.

KEY WORDS: Modied Equal Width Wave Equation, Finite Elements

Method, B-Spline Fun tions, Galerkin Method, Petrov-Galerkin Method,

(9)

Doktora e§itimim süresin e dan³manl§m yürüten ve bu tezin hazrlanmas

srasnda her zaman yakn ilgi ve yardmlarngördü§üm de§erli ho am Sayn Yrd.

Doç. Dr. Turabi GEYKL'ye ayr a yüksek lisans ve doktora süresin e bana

sürekli yardm  olan bölüm ba³kanmz, Sayn Prof. Dr. Sadk KELE“'in

³ah-snda bütün bölüm ho alarma, kar³la³t§m güçlüklerin üstesinden gelmem için

bana yol gösteren de§erli ho alarm Doç. Dr. Alaattin ESEN ve Prof. Dr. Bilal

ALTAY'a,tez süresin e banaherzaman destekolan de§erliarkada³larmÖ§r. Grv.

Dr. N. Murat YA‡MURLU ve Ö§r. Grv. Dr. Yusuf UÇAR'a, sabr ve sevgi ile

bana destek olan e³im Meltem, kzlarm Elif Azra ve Zehra Rana'ya, hiçbir zaman

(10)

ÖZET i ABSTRACT iii TE“EKKÜR v ÇNDEKLER vi GR“ 1 1 TEMEL KAVRAMLAR 4

1.1 Sonlu Fark Yöntemleri . . . 4

1.2 Varyasyonel Yöntemler . . . 5

1.2.1 Rayleigh-RitzYöntemi . . . 6

1.3 A§rlklKalan Yöntemleri . . . 7

1.3.1 Galerkin Yöntemi . . . 8

1.3.2 Petrov-Galerkin Yöntemi . . . 8

1.3.3 KollokasyonYöntemi . . . 9

1.3.4 Subdomain Yöntemi . . . 10

1.4 Sonlu ElemanlarYöntemi . . . 10

1.5 Spline Fonksiyonlar . . . 12

1.6 B-Spline Fonksiyonlar. . . 15

1.6.1 Lineer B-Spline Fonksiyonlar . . . 16

1.6.2 Kuadratik B-Spline Fonksiyonlar . . . 18

1.6.3 Kübik B-SplineFonksiyonlar . . . 19

1.6.4 Kuartik B-Spline Fonksiyonlar . . . 21

1.6.5 Kuintik B-Spline Fonksiyonlar . . . 22

1.6.6 Sektik B-Spline Fonksiyonlar . . . 25

1.6.7 Septik B-Spline Fonksiyonlar. . . 27

(11)

2 MODFYEEDLM“ E“TGEN“LKLDALGA

DENKLEM-NN GALERKIN SONLU ELEMAN YÖNTEM LE ÇÖZÜMÜ 36

2.1 KuadratikB-spline Fonksiyonlar ileGalerkin Yöntemi . . . 37

2.2 Kübik B-spline Fonksiyonlar ileGalerkin Yöntemi . . . 49

3 MODFYE EDLM“ E“T GEN“LKL DALGA

DENKLEM-NN PETROV-GALERKIN SONLU ELEMAN YÖNTEM LE

ÇÖZÜMÜ 73

3.1 KuadratikB-spline Fonksiyonlar ilePetrov-Galerkin Yöntemi. . . . 73

3.2 Kübik B-spline Fonksiyonlar ilePetrov-Galerkin Yöntemi . . . 92

4 MODFYE EDLM“ E“T GEN“LKL DALGA

DENKLEM-NNSUBDOMAINSONLUELEMANYÖNTEMLEÇÖZÜMÜ 113

4.1 Kuartik B-spline Fonksiyonlar ile Subdomain Yöntemi . . . 113

4.2 Sektik B-spline Fonksiyonlar ile Subdomain Yöntemi . . . 133

5 MODFYE EDLM“ E“T GEN“LKL DALGA

DENKLEM-NN KOLLOKASYON SONLU ELEMAN YÖNTEM LE

ÇÖ-ZÜMÜ 154

5.1 Kübik B-spline KollokasyonYöntemi . . . 154

5.2 Kuintik B-spline KollokasyonYöntemi . . . 177

5.3 Septik B-spline KollokasyonYöntemi . . . 193

KAYNAKLAR 215

(12)

Tablo 1.1

Q

m

(x)

ve

Q

m

(x)

'indü§ümnoktalarndakide§erleri. . . 18 Tablo 1.2

φ

m

(x), φ

m

(x)

ve

φ

′′

m

(x)

'in dü§ümnoktalarndakide§erleri. . . 20 Tablo 1.3

φ

m

(x), φ

m

(x), φ

′′

m

(x)

ve

φ

′′′

m

(x)

'in dü§ümnoktalarndakide§erleri. . 22 Tablo 1.4

φ

m

(x), φ

i

(x), φ

′′

i

(x), φ

′′′

i

(x)

ve

φ

(ıv)

i

(x)

'indü§üm noktalarndaki de§er-leri. . . 24 Tablo 1.5

φ

m

(x), φ

m

(x), φ

′′

m

(x), φ

′′′

m

(x), φ

(ıv)

m

(x)

ve

φ

(v)

m

(x)

'in dü§üm noktalarn-daki de§erleri. . . 26 Tablo 1.6

φ

m

(x)

,

φ

m

(x), φ

′′

m

(x), φ

′′′

m

(x), φ

(ıv)

m

(x), φ

(v)

m

(x)

ve

φ

(vı)

m

(x)

'nndü§üm nok-talarndaki de§erleri. . . 28

Tablo 2.1

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 42

Tablo 2.2

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ile elde edilensaysalde§erleri. . . 43

Tablo 2.3

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 43

Tablo 2.4

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 44

Tablo 2.5

µ = 1

,

h = 0.1

,

A = 0.25

,

∆t = 0.05

,

0 ≤ x ≤ 80

için Problem 1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 46

Tablo 2.6

µ = 1

,

h = 0.1

,

A = 0.25

,

0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 47

Tablo 2.7

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 3 ileelde edilen korunum sabitleri. . . 47

Tablo 2.8

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 3 ileelde edilen korunum sabitleri. . . 48

(13)

Tablo 2.9

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 48

Tablo 2.10

µ = 1

,

h = 0.1

,

A = 0.25

,

0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 49

Tablo 2.11

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 49

Tablo 2.12

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 50

Tablo 2.13

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 55

Tablo 2.14

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ile elde edilensaysalde§erleri. . . 55

Tablo 2.15

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 56

Tablo 2.16

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem 1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 57

Tablo 2.17

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama2ileelde edilenkonum,genlikvehzde§erleri. 58

Tablo 2.18

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata normlar. . . 60

Tablo 2.19Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 2 ile elde edilen konum, genlik ve hz de§erleri. . . 60

Tablo 2.20

∆t = 0.05

,

A = 0.25

,

t = 20

,

0 ≤ x ≤ 80

için hesaplanan hata normlarve yaknsama oranlar. . . 61

Tablo 2.21

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 61

Tablo 2.22Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [38℄'de elde edilen sonuçlarla kar³la³trlmas. 62 Tablo 2.23

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

(14)

Tablo 2.24Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [38℄'de elde edilensonuçlarla kar³la³trl-mas. . . 63

Tablo 2.25

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 65

Tablo 2.26

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 65

Tablo 2.27

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 67

Tablo 2.28

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 67

Tablo 2.29

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 68

Tablo 2.30

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 68

Tablo 2.31

µ = 1, A = 0.25, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§ndaProblem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 69

Tablo 2.32

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 69

Tablo 2.33

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 70

Tablo 2.34

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 70

Tablo 2.35Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, µ = 1, A = 0.25,

∆t = 0.05,

için

t = 20

'de farkl uygulama ve çal³malardan elde edilen korunum sabitlerivehata norm de§erleri. . . 71

Tablo 3.1

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 77

Tablo 3.2

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 77

(15)

Tablo 3.3

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 78

Tablo 3.4

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 79

Tablo 3.5

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama2ileelde edilenkonum,genlikvehzde§erleri. 80

Tablo 3.6

h = 0.1

,

∆t = 0.01

,

0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata norm de§erleri. . 81

Tablo 3.7 Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 2 ile elde edilen konum, genlik ve hz de§erleri. . . 81

Tablo 3.8

∆t = 0.05

,

A = 0.25

,

t = 20

,

0 ≤ x ≤ 80

, için hesaplanan hata normlarve yaknsama oranlar. . . 82

Tablo 3.9

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

µ = 1

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 83

Tablo 3.10Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [38℄'de elde edilen sonuçlarla kar³la³trlmas. 84 Tablo 3.11

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

Uygulama 2 ileelde edilen saysal de§erleri.. . . 85

Tablo 3.12Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [38℄'de elde edilensonuçlarla kar³la³trl-mas. . . 86

Tablo 3.13

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 87

Tablo 3.14

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 87

Tablo 3.15

µ = 1

,

A = 0.25

,

∆t = 0.05

,

0 ≤ x ≤ 80

içinProblem1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 90

Tablo 3.16

µ = 1

,

h = 0.1

,

A = 0.25

,

0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 90

(16)

Tablo 3.17

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen saysal de§erleri.. . . 91

Tablo 3.18

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 91

Tablo 3.19

µ = 1, A = 0.25, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§ndaProblem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 92

Tablo 3.20

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 92

Tablo 3.21

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 93

Tablo 3.22

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 93

Tablo 3.23

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 97

Tablo 3.24

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ile elde edilensaysalde§erleri. . . 97

Tablo 3.25

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 98

Tablo 3.26

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 99

Tablo 3.27

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama2ileelde edilenkonum,genlikvehzde§erleri.100

Tablo 3.28

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata normlar. . . 101

Tablo 3.29Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 2 ile elde edilen konum, genlik ve hz de§erleri. . . 101

Tablo 3.30

∆t = 0.05

,

0 ≤ x ≤ 80

,

A = 0.25

,

t = 20

için hesaplanan hata normlarve yaknsama oranlar. . . 102

Tablo 3.31

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 102

(17)

Tablo 3.32Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [38℄'de elde edilen sonuçlarla kar³la³trlmas.103 Tablo 3.33

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

Uygulama 2 ileelde edilen saysal de§erleri.. . . 103

Tablo 3.34Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [38℄'de elde edilensonuçlarla kar³la³trl-mas. . . 104

Tablo 3.35

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 104

Tablo 3.36

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 105

Tablo 3.37

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 106

Tablo 3.38

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 107

Tablo 3.39

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5 0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 107

Tablo 3.40

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1 0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 108

Tablo 3.41

µ = 1, A = 0.25, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§ndaProblem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 108

Tablo 3.42

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 109

Tablo 3.43

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 109

Tablo 3.44

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 110

Tablo 3.45Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, µ = 1, A = 0.25,

∆t = 0.05,

için

t = 20

' de farkl uygulama ve çal³malardan elde edilen korunum sabitlerivehata norm de§erleri. . . 111

(18)

Tablo 4.1

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 118

Tablo 4.2

µ = 1, A = 0.25, h = 0.1

ve

0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 119

Tablo 4.3

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 120

Tablo 4.4

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 121

Tablo 4.5

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama2ileelde edilenkonum,genlikvehzde§erleri.121

Tablo 4.6

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata norm de§erleri. . 123

Tablo 4.7 Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 2 ile elde edilen konum, genlik ve hz de§erleri. . . 123

Tablo 4.8

∆t = 0.05

,

A = 0.25

,

t = 20

,

0 ≤ x ≤ 80

, için hesaplanan hata normlarve yaknsama oranlar. . . 124

Tablo 4.9

h = 0.1

,

µ = 1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 125

Tablo 4.10Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [38℄'de elde edilen sonuçlarla kar³la³trlmas.125 Tablo 4.11

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

Uygulama 2 ileelde edilen saysal de§erleri.. . . 127

Tablo 4.12Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [38℄'de elde edilensonuçlarla kar³la³trl-mas. . . 127

Tablo 4.13

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 128

Tablo 4.14

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 129

(19)

Tablo 4.15

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 130

Tablo 4.16

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 130

Tablo 4.17

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 131

Tablo 4.18

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 131

Tablo 4.19

µ = 1, A = 0.25, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§ndaProblem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 132

Tablo 4.20

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 133

Tablo 4.21

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 133

Tablo 4.22

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 134

Tablo 4.23

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 138

Tablo 4.24

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ile elde edilensaysalde§erleri. . . 139

Tablo 4.25

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 140

Tablo 4.26

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 141

Tablo 4.27

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama2ileelde edilenkonum,genlikvehzde§erleri.141

Tablo 4.28

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata normlar. . . 142

Tablo 4.29Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

(20)

Tablo 4.30

∆t = 0.05

,

A = 0.25

,

t = 20

,

0 ≤ x ≤ 80

, için hesaplanan hata normlarve yaknsama oranlar. . . 143

Tablo 4.31

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 144

Tablo 4.32Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [38℄'de elde edilen sonuçlarla kar³la³trlmas.144 Tablo 4.33

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

Uygulama 2 ileelde edilen saysal de§erleri.. . . 145

Tablo 4.34Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [38℄'de elde edilensonuçlarla kar³la³trl-mas. . . 145

Tablo 4.35

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 146

Tablo 4.36

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 147

Tablo 4.37

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 148

Tablo 4.38

µ = 1

,

h = 0.1

,

A = 0.25

,

0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 148

Tablo 4.39

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 149

Tablo 4.40

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 149

Tablo 4.41

µ = 1, A = 0.25, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§ndaProblem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 150

Tablo 4.42

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 150

Tablo 4.43

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 151

Tablo 4.44

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 5 ileelde edilen korunum sabitleri. . . 151

(21)

Tablo 4.45Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, µ = 1, A = 0.25,

∆t = 0.05,

için

t = 20

'de farkl uygulama ve çal³malardan elde edilen korunum sabitlerivehata norm de§erleri. . . 152

Tablo 5.1

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 158

Tablo 5.2

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ile elde edilensaysalde§erleri. . . 159

Tablo 5.3

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama1ileelde edilenkonum,genlikvehzde§erleri.160

Tablo 5.4

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1' in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata norm de§erleri. . 161

Tablo 5.5 Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 1 ile elde edilen konum, genlik ve hz de§erleri. . . 162

Tablo 5.6

∆t = 0.05

,

0 ≤ x ≤ 80

,

A = 0.25

,

t = 20

için hesaplanan hata normlarve yaknsama oranlar. . . 163

Tablo 5.7

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 1 ileelde edilen saysal de§erleri.. . . 163

Tablo 5.8 Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [32℄'de elde edilen sonuçlarla kar³la³trlmas.164 Tablo 5.9

h = 0.1

,

µ = 1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

Uygulama 1 ileelde edilen saysal de§erleri.. . . 165

Tablo 5.10Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [36℄'da elde edilen sonuçlarla kar³la³trl-mas. . . 166

Tablo 5.11Maxwellian ba³langç ³artnn farkl

µ

de§erleri için elde edilen ko-runum sabitleri. . . 167

Tablo 5.12

µ = 1, A = 0.25, h = 0.1

ve

0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 167

(22)

Tablo 5.13

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 169

Tablo 5.14

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 169

Tablo 5.15

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

içinProblem 1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 170

Tablo 5.16

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 3 ileelde edilen korunum sabitleri. . . 171

Tablo 5.17

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 3 ileelde edilen korunum sabitleri. . . 171

Tablo 5.18Maxwellian ba³langç ³artnn farkl

µ

de§erleri için elde edilen ko-runum sabitleri. . . 172

Tablo 5.19

µ = 1, A = 0.25, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§ndaProblem 1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 172

Tablo 5.20

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 4 ileelde edilen saysal de§erleri.. . . 173

Tablo 5.21

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 174

Tablo 5.22

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 174

Tablo 5.23Maxwellian ba³langç ³artnn farkl

µ

de§erleri için elde edilen ko-runum sabitleri. . . 175

Tablo 5.24

µ = 1

,

h = 0.1

,

A = 0.25

,

∆t = 0.05

,

0 ≤ x ≤ 80

için Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 175

Tablo 5.25

µ = 1, A = 0.25, h = 0.1

için

0 ≤ x ≤ 80

aral§nda Problem 1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 176

Tablo 5.26

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2' nin Uygulama 5 ileelde edilen korunum sabitleri. . . 176

Tablo 5.27

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 181

(23)

Tablo 5.28

µ = 1, A = 0.25, h = 0.1

ve

0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 181

Tablo 5.29

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in Uygulama 2 ileelde edilen saysal de§erleri.. . . 182

Tablo 5.30

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 183

Tablo 5.31

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 184

Tablo 5.32

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 2 ileelde edilen saysal de§erleri.. . . 184

Tablo 5.33Maxwellian ba³langç ³artnn farkl

µ

de§erleri için elde edilen ko-runum sabitleri. . . 185

Tablo 5.34

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 185

Tablo 5.35

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 186

Tablo 5.36

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'inUygulama3ileeldeedilenkonum,genlikvehzde§erleri. 187

Tablo 5.37

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata norm de§erleri. . 188

Tablo 5.38Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 3 ile elde edilen konum, genlik ve hz de§erleri. . . 188

Tablo 5.39

∆t = 0.05

,

0 ≤ x ≤ 80

,

A = 0.25

,

t = 20

için hesaplanan hata normlarve yaknsama oranlar. . . 189

Tablo 5.40

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 3 ileelde edilen saysal de§erleri.. . . 189

Tablo 5.41

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

∆t = 0.025

için

0 ≤ x ≤ 80

aral§nda Problem2'nin referans[43℄ileelde edilensonuçlarilekar³la³trlmas.190

(24)

Tablo 5.43Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

=

1

,

∆t = 0.025

içinreferans [38℄'de elde edilensonuçlarla kar³la³trl-mas. . . 191

Tablo 5.44Maxwellian ba³langç³artnn farkl

µ

de§erleriiçin korunum sabitleri.191 Tablo 5.45

µ = 1, A = 0.25, ∆t = 0.05

ve

0 ≤ x ≤ 80

için Problem 1'in

Uygulama 4 ileelde edilen saysal de§erleri.. . . 192

Tablo 5.46

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 193

Tablo 5.47

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2' nin Uygulama 4 ileelde edilen korunum sabitleri. . . 193

Tablo 5.48

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 1 ileelde edilen saysal de§erleri.. . . 198

Tablo 5.49

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 1 ile elde edilensaysalde§erleri. . . 199

Tablo 5.50

µ = 1, A = 0.25, h = 0.1, ∆t = 0.05

için

0 ≤ x ≤ 80

aral§nda Problem1'in Uygulama1ileelde edilenkonum,genlikvehzde§erleri.199

Tablo 5.51

h = 0.1, ∆t = 0.01, 0 ≤ x ≤ 80

olmak üzere Problem 1'in farkl

A

de§erleriiçin elde edilenkorunum sabitlerive hata normlar. . . 200

Tablo 5.52Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.05

ve

A = 0.25,

0.5, 0.75, 1.0

de§erleri içinUygulama 2 ile elde edilen konum, genlik ve hz de§erleri. . . 201

Tablo 5.53

∆t = 0.05

,

A = 0.25

,

t = 20

,

0 ≤ x ≤ 80

, için hesaplanan hata normlarve yaknsama oranlar. . . 201

Tablo 5.54

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 1 ileelde edilen saysal de§erleri.. . . 202

Tablo 5.55Problem 2'nin

0 ≤ x ≤ 80

aral§nda

h = 0.1, A

1

= 1, A

2

= 0.5,

∆t = 0.025

içinreferans [43℄'de elde edilen sonuçlarla kar³la³trlmas.202 Tablo 5.56

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin

(25)

Tablo 5.57Problem2'nin

0 ≤ x ≤ 150

aral§nda

µ = 1, h = 0.1, A

1

= −2, A

2

=

1, ∆t = 0.025

içinreferans [36℄'da elde edilen sonuçlarla kar³la³trl-mas. . . 203

Tablo 5.58Maxwellian ba³langç³artnn farkl

µ

de§erleriiçin korunum sabitleri.204 Tablo 5.59

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama

2 ileelde edilen saysal de§erleri.. . . 205

Tablo 5.60

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 2 ile elde edilensaysalde§erleri. . . 205

Tablo 5.61

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 3 ileelde edilen saysal de§erleri.. . . 207

Tablo 5.62

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 3 ile elde edilensaysalde§erleri. . . 207

Tablo 5.63

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 3 ileelde edilen saysal de§erleri.. . . 208

Tablo 5.64

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 3 ileelde edilen korunum sabitleri. . . 208

Tablo 5.65Maxwellian ba³langç³artnn farkl

µ

de§erleriiçin korunum sabitleri 209 Tablo 5.66

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama

4 ileelde edilen saysal de§erleri.. . . 210

Tablo 5.67

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 4 ile elde edilensaysalde§erleri. . . 210

Tablo 5.68

µ = 1

,

h = 0.1

,

A

1

= 1

,

A

2

= 0.5

,

0 ≤ x ≤ 80

için Problem 2'nin Uygulama 4 ileelde edilen saysal de§erleri.. . . 211

Tablo 5.69

µ = 1

,

h = 0.1

,

A

1

= −2

,

A

2

= 1

,

0 ≤ x ≤ 150

için Problem 2'nin Uygulama 4 ileelde edilen korunum sabitleri. . . 211

Tablo 5.70

µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80

içinProblem1'in Uygulama 5 ileelde edilen saysal de§erleri.. . . 212

Tablo 5.71

µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80

için Problem1'in Uygulama 5 ile elde edilensaysalde§erleri. . . 213

(26)

Tablo 5.72Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, µ = 1, A = 0.25,

∆t = 0.05

için

t = 20

' de farkl uygulama ve çal³malardan elde edilen korunum sabitleri. . . 214

Tablo 5.73Problem 1'in

0 ≤ x ≤ 80

aral§nda

h = 0.1, µ = 1, A = 0.25,

∆t = 0.05

için

t = 20

' de farkl uygulama ve çal³malardan elde edilen hata norm de§erleri. . . 214

(27)

“ekil 1.1 Birin iDere eden Spline Fonksiyon. . . 14

“ekil 1.2 Sfrn Dere eden B-Spline Fonksiyon. . . 15

“ekil 1.3 Lineer B-spline “ekil Fonksiyonlar. . . 17

“ekil 1.4 KuadratikB-spline “ekilFonksiyonlar. . . 19

“ekil 1.5 Kübik B-spline “ekilFonksiyonlar. . . 21

“ekil 1.6 Kuartik B-spline “ekil Fonksiyonlar. . . 23

“ekil 1.7 Kuintik B-spline “ekilFonksiyonlar. . . 25

“ekil 1.8 Sektik B-spline “ekilFonksiyonlar. . . 27

“ekil 1.9 Septik B-spline “ekil Fonksiyonlar. . . 29

“ekil 2.1 Solitary dalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 0

ve

t = 20

'dekihareketi. . . 58 “ekil 2.2 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki

hata gra§i. . . 59

“ekil 2.3 Solitary dalgann

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.01

için

t = 20

zamanndafarkl

A

de§erleriiçinelde edilengrakleri. . . 59 “ekil 2.4

h = 0.1, A

1

= 1, A

2

= 0.5, µ = 1, 0 ≤ x ≤ 80

içinpozitifgenlikliiki

solitary dalganngiri³imi.. . . 62

“ekil 2.5

t = 80

için“ekil2.4'ün gra§ininbüyütülmü³³ekli. . . 63 “ekil 2.6

h = 0.1, A

1

= −2, A

2

= 1, µ = 1, 0 ≤ x ≤ 150

için iki dalgann

giri³imi. . . 64

“ekil 3.1 Solitary dalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 0

ve

20

'dekihareketi. . . 80 “ekil 3.2 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki

(28)

“ekil 3.3 Solitary dalgann

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.01

için

t = 20

zamanndafarkl

A

de§erleriiçinelde edilengrakleri. . . 82 “ekil 3.4

h = 0.1, A

1

= 1, A

2

= 0.5, µ = 1, 0 ≤ x ≤ 80

içinpozitifgenlikliiki

dalganngiri³imi. . . 84

“ekil 3.5

t = 80

için“ekil3.4'ün gra§ininbüyütülmü³³ekli. . . 85 “ekil 3.6

h = 0.1, A

1

= −2, A

2

= 1, µ = 1, 0 ≤ x ≤ 150

için iki dalgann

giri³imi. . . 86

“ekil 3.7 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki hata gra§i. . . 100

“ekil 4.1 Solitary dalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 0

ve

20

'dekihareketi. . . 122 “ekil 4.2 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki

hata gra§i. . . 122

“ekil 4.3 Solitary dalgann

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.01

için

t = 20

zamanndafarkl

A

de§erleriiçinelde edilengrakleri. . . 124 “ekil 4.4

h = 0.1, A

1

= 1, A

2

= 0.5, µ = 1, 0 ≤ x ≤ 80

içinpozitifgenlikliiki

dalgannetkile³imi. . . 126

“ekil 4.5

t = 80

için“ekil4.4'ün gra§ininbüyütülmü³³ekli. . . 126 “ekil 4.6

h = 0.1, A

1

= −2, A

2

= 1, µ = 1, 0 ≤ x ≤ 150

için iki dalgann

giri³imi. . . 128

“ekil 4.7 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki hata gra§i. . . 142

“ekil 5.1 Solitary dalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 0

ve

20

'dekihareketi. . . 160 “ekil 5.2 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki

hata gra§i. . . 161

“ekil 5.3 Solitary dalgann

0 ≤ x ≤ 80

aral§nda

h = 0.1, ∆t = 0.01

için

t = 20

zamanndafarkl

A

de§erleriiçinelde edilengrakleri. . . 162 “ekil 5.4

h = 0.1, A

1

= 1, A

2

= 0.5, µ = 1, 0 ≤ x ≤ 80

içinpozitifgenlikliiki

(29)

“ekil 5.5

t = 80

için“ekil5.4'ün gra§ininbüyütülmü³³ekli. . . 165 “ekil 5.6

h = 0.1, A

1

= −2, A

2

= 1, µ = 1, 0 ≤ x ≤ 150

için iki dalgann

giri³imi. . . 166

“ekil 5.7 Maxwellian ba³langç ³artnn

t = 12

'de

a) µ = 1, b) µ = 0.5, c) µ =

0.1, d) µ = 0.05, e) µ = 0.02, f ) µ = 0.005

de§erleriiçingra§i. . . 168 “ekil 5.8 Solitary dalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

zamanndaki hata gra§i.. . . 187

“ekil 5.9 Solitarydalgann

h = 0.1, ∆t = 0.05, µ = 1, A = 0.25

için

t = 20

'deki hata gra§i. . . 200

(30)

Do§adakiher olay ister biyolojik,ister jeolojik, ister mekanikolsun zik

kural-laryardmylamatematiksel olarakifadeedilebilir. Bu olaylarnço§umatematiksel

olarak modellendi§inde diferansiyel, ebirsel veya integral denklemler elde edilir.

Bilim adamlarvemühendislerbilinenanalitik yöntemlerleçözümü zor veya

imkan-sz olan lineer olmayan diferansiyel denklemlerle oldukça sk kar³la³rlar. Bu tip

denklemlerle kar³la³an bilim adamlar ve mühendisler tam çözümü veren analitik

yöntemler yerine yakla³k çözümü veren saysal yöntemler kullanrlar. Son

zaman-larda bu saysal yöntemlerden; sonlu fark yöntemi, varyasyonel yöntemler, a§rlkl

kalanyöntemleriveözellikle sonluelemanlaryöntemidaha sklklakullanlmaktadr

[1, 2℄.

Sonlu elemanlaryöntemi verilen bir bölgeyi sonlu eleman ad verilen basit alt

bölgelerin kolleksiyonu olarak gösteren bir yöntemdir. Bu gösterim her bir eleman

üzerinde varyasyonel veya a§rlkl kalan yöntemlerinin ihtiyaç duydu§u yakla³m

fonksiyonlarn sistematik olarak üretmeyi sa§lar. Böyle e sonlu eleman yöntemi

yakla³mfonksiyonlarnnolu³turulmasaçsndanvaryasyonelvea§rlklkalan

yön-temlerinden farkldr. Bu farkllk sonlu elemanlar yönteminin a³a§daki üç temel

özelli§inden kaynaklanr [1℄:

1. Bütünün parçalara bölünmesi; yakla³m fonksiyonlarnn sistematik olarak

türetilmesi içingeometrikolarakkarma³k olanbölgeler,basit bölgelerinbir

kollek-siyonu ³eklinde temsiledilebilir.

2. Her bir eleman üzerinde yakla³m fonksiyonlarnn türetilmesi; bunlar daha

çok interpolasyon teorisikullanlarak türetilen ebirsel polinomlardr.

3. Elemanlarn birle³tirilmesi;çözümün süreklili§ineve içkuvvetlerin dengesine

dayanr.

(31)

larngeometrisi,yakla³mfonksiyonlarntekolaraktüretilebile ek³ekildeolmaldr.

Yakla³m fonksiyonlar sade e geometrik yapya de§il ayn zamanda dü§üm(node)

diye adlandrlan noktalarn yerine ve saysna da ba§ldr. Sonlu eleman

yöntemi-nintemelkri,süreklifonskiyonlaryerinegenelliklepolinomlarolanparçalyakla³m

fonksiyonlarn kullanmaktr.

Sonluelemanlaryöntemiliteratürdelineerveyalineerolmayanbirçokdiferansiyel

denkleme yaygn olarakuygulanm³tr. Bu diferansiyel denklemlere örnek olarak

Burgers denklemi:

U

t

+ UU

x

− υU

xx

= 0

Korteweg-de Vries (KdV) denklemi:

U

t

+ εUU

x

+ µU

xxx

= 0

Modied Korteweg-de Vries (MKdV) denklemi:

U

t

+ εU

2

U

x

+ µU

xxx

= 0

Regularized Long Wave (RLW) denklemi:

U

t

+ U

x

+ εUU

x

− µU

xxt

= 0

Modied Regularized Long Wave (MRLW) denklemi:

U

t

+ U

x

+ 6U

2

U

x

− µU

xxt

= 0

EqualWidth Wave (EW)denklemi:

U

t

+ εUU

x

− µU

xxt

= 0

verilebilir. Bu çal³mada, s§olmayansu dalgalarve iyonakustik plazmadalgalar

gibi bir çok önemli ziksel olay tanmlayanEW denkleminin modiye edilmi³ hali

olan

U

t

+ 3U

2

U

x

− µU

xxt

= 0

(32)

MEWdenklemindeki

U

2

U

x

lineerolmayanterimiyerinebazyakla³mlarkullanlarak

(33)

TEMEL KAVRAMLAR

Bu bölümde; sonlu fark, varyasyonel ve a§rlkl kalan yöntemlerinden ksa a

bahsedildikten sonra tezde kullanla ak sonlu elemanlar yöntemi ile spline ve

B-spline fonksiyonlar hakknda baz temel bilgiler verile ektir. Ayr a bu bölümde

sonlu elemanlar yöntemi kullanlarak saysal çözümleri elde edile ek olan MEW

denklemi, farkl ba³langçvesnr ³artlar ile birlikte tantla aktr.

1.1 Sonlu Fark Yöntemleri

Farkl ba³langç ve snr ³artlar ile verilen lineer ve lineer olmayan bir çok

ksmidiferansiyeldenkleminyakla³kçözümündesonlufarkyöntemleriyaygnolarak

kullanlmaktadr. Birksmidiferansiyeldenkleminsonlufarkyakla³mneldeetmek

için srasyla a³a§dakiadmlar uygulanr[3℄:

1. Problemin çözüm bölgesi e³it veya farkl boyutta geometrik ³ekiller içeren

kafeslere bölünür ve problemin yakla³k çözümü her bir kafesin dü§üm noktalar

üzerinden hesaplanr.

2. Diferansiyel denklemde görülen türevler yerine Taylor seri açlm ile elde

edilen ileri, geri veya merkezi sonlu fark yakla³mlarndan biri yazlr. Böyle e

ba³langçta verilen diferansiyel denklemin çözümü problemi fark denklemlerinden

olu³an bir ebirseldenklem sistemininçözümü problemineindirgenir.

3. Elde edilen fark denkleminde çözüm bölgesi içinde olmayan hayali dü§üm

noktalar yok etmek için problem ile verilen snr ³artlar yerine uygun sonlu fark

yakla³mlaryazlr. Böyle e bilinmeyen sayskadar ebirseldenklemden olu³anbir

denklem sistemi elde edilir. Elde edilen bu ebirsel denklem sistemi direkt veya

iteratif yöntemlerden biri yardm ilekolay a çözülür.

Bir diferansiyel denklem sonlu fark formunda a³a§daki yöntemlerden biri

(34)

2. Kapal (Impli it)

3. Crank-Ni olson

Sonlu fark yönteminde

a ≤ x ≤ b

ve

t > 0

olmak üzereproblemin

U

N

(x, t)

yakla³k çözümü dü§üm noktalar üzerinde ola ak ³ekilde problemin çözüm bölgesi

N

alt aral§a bölünür. Bu bölünme i³leminde herbir

∆t ≡ k

zaman adm için

∆x ≡ h =

b−a

N

ola ak ³ekilde e³it aralklar göz önüne alnr. Dü§üm noktalarnda

problem ilebirlikte verilen snr ³artlar uygulandktan sonra elde edilen fark

denk-lemleri çözülerek problemin yakla³k çözümü bulunur. Sonlu fark yöntemi kolay

uygulanabilir bir yöntem olmasna ra§men düzgün olmayan snr ³artlarnn

uygu-lanmasndaki zorluklar, karma³k bölgelerde geometriksel gösterimin

do§rulu§un-daki zorluklar ve yakla³k çözümdeki türevlerin yanl³l§ gibi baz dezavantajlara

sahiptir.

1.2 Varyasyonel Yöntemler

Varyasyonel yöntemler ise tam çözüm yerine kullanla ak yakla³k çözümü,

diferansiyel denklemin zayf formundan veya kuadratik fonksiyonelin

minimumun-danveyaa§rlklintegralifadesindeneldeederler. Buyöntemlerdenbazlar

Rayleigh-Ritzvea§rlkl-kalanyöntemleri'(Galerkin,Petrov-Galerkin,kollokasyonve

subdo-main yöntemleri)dir. Bu yöntemlerde bir problemin yakla³k çözümü

X

c

j

φ

j

+ φ

0

³eklinde aranr. Burada

φ

j

'ler genellikle polinom olan uygun yakla³m fonksiyon-lar ve

c

j

'ler ise hesaplana ak bilinmeyen parametrelerdir.

c

j

parametreleri denkle-mina§rlklintegral formunuveyazayfformunusa§laya ak³ekilde veya denkleme

kar³lk gelen kuadratik fonksiyoneli minimum yapa ak ³ekilde bulunur.

X

c

j

φ

j

0

yakla³mverilendiferansiyeldenklemdedo§rudanyazlrsa

c

j

paramet-relerininbulunmas içinher zamangerekli veyeterlisaydalineer ba§mszdenklem

sistemi elde edilemeyebilir. Bu nedenle a§rlklintegralforma ihtiyaç duyulur.

A§rlklintegralform,

X

c

j

φ

j

+ φ

0

yakla³k çözümünün diferansiyel denk-lemde yerine yazlmasyla elde edilen kalan ile

W

a§rlk fonksiyonunun çarpmnn bölge üzerindeki integralinin ifadesidir. A§rlkl integral formunda

u

N

yakla³k

(35)

çözümündeki

φ

j

yakla³mfonksiyonlardiferansiyeldenkleminmertebesikadar türev-lenebilirolmalveproblemilebirlikteverilentümsnr³artlarnsa§lamaldr. Çünkü

a§rlkl integral form problemin hiçbir snr ³artn içermez. A§rlkl integral

for-munda

W

a§rlk fonksiyonunun lineer ba§msz

N

farkl seçimi için

c

1

, c

2

, ..., c

N

bilinmeyenlerindenolu³an

N

tane ebirseldenklemelde edilir. Budenklemlerden

c

j

parametreleri kolay aelde edilir.

Zayf form ise denklemdeki diferansiyelin ba§ml de§i³ken ile a§rlk

fonk-siyonu arasnda payla³trld§ ve ayn zamanda verilen problemin do§al snr

³art-larniçerena§rlklintegralifadesidir. Verilenherdenklemina§lklintegralifadesi

elde edilebilirken, zayfformuelde edilemeyebilir. Varyasyonel yöntemler

W

a§rlk fonksiyonuve

φ

j

yakla³mfonksiyonlarnnseçimibakmndanbiribirinden farkldr-lar. Varyasyonel yöntemlerde yakla³k çözüm bulunurken verilen denkleme kar³lk

gelen zayf form kullanlr. Her denklemin zayf formu olu³turulamayabile e§i için

snrlsaydadenkleme uygulanabilirler[1℄.

1.2.1 Rayleigh-Ritz Yöntemi

Rayleigh-Ritz yönteminde, yakla³mn

c

j

katsaylar verilen problemin zayf formu kullanlarak elde edilir. A§rlk fonksiyonlar ile yakla³m fonksiyonlar ayn

(W = φ

i

)

seçilir. Zayfformhemdiferansiyeldenklemihemde problemindo§alsnr ³artlarn içerdi§inden, yakla³m fonksiyonlar üzerindeki süreklilik gerektirmeleri,

orijinal diferansiyeldenklem veya a§rlklintegral formdaki gerektirmelerden daha

azdr. Rayleigh-Ritz yöntemindeyakla³kçözüm,

u

N

=

N

X

j=1

c

j

φ

j

+ φ

0

biçiminde sonlu bir seri ³eklinde aranr. Burada

c

j

sabitleri Ritz katsaylar olarak adlandrlr. Denklemin zayf formunda a§rlk fonksiyonlar yerine yakla³m

fonk-siyonlar yazlrsa

c

j

(j = 1, 2, .., N)

bilinmeyenleriiçin

N−

adet lineer ba§msz e-birsel denklem sistemielde edilir.

φ

j

ve

φ

0

yakla³m fonskiyonlarbir takm³artlar sa§lamaldr.

u

N

yakla³m, problem ile verilen temel snr ³artlarn sa§lamaldr. Çünküzayfformproblemindo§alsnr³artlarniçermektedir.

φ

0

fonksiyonununtek

(36)

tr.

φ

0

fonksiyonu yerine temel snr ³artlarn sa§layan dü³ük dere eden herhangi bir fonksiyonkullanlabilir. E§er temel snr ³artlarnnhepsi homojen ise o zaman

φ

0

= 0

olur.

φ

j

yakla³m fonksiyonlar ise a³a§daki³artlar sa§lamaldrlar.

1.

φ

j

yakla³m fonksiyonlar, verilen problemin temel snr ³artlarnn homojen ksmnsa§lamaldr.

2. Herhangi bir

N

de§eri için,

j

}

N

j=1

kümesi lineer ba§mszolmaldr.

3.

j

}

yakla³m fonksiyonlartam olmaldr.

φ

j

yakla³m fonksiyonlar ebirsel polinomlarise, tamlk

j

}

yakla³m fonksiyonlar kümesinin izin verilen en dü³ük dere eden, istenilen en yüksek dere eye kadar tüm terimleriniiçermelidir[1℄.

1.3 A§rlkl Kalan Yöntemleri

Bir diferansiyel denklemin tam çözümü ile yakla³k çözümü arasndaki farkn,

sfrdan farkl bir a§rlk fonksiyonu ile çarplp toplamlarnn en küçük yaplmas

i³lemi, a§rlklkalan yakla³molarakbilinir. Bu yakla³ma dayanan yöntemlereise

a§rlkl kalan yöntemleri denir. Her denklemin a§rlkl integral formu

olu³turulabile e§i için her denkleme uygulanabilirler. Dolaysyla varyasyonel

yön-temlerdendahageni³biraralktakiproblemlereuygulanabilirler. A§rlklkalan

yön-temleri her denklemin a§rlkl integral formunu olu³turmakta kullanlabilir.

A§rlkl integral formproblemin snr ³artlarndan hiçbiriniiçermedi§inden, a§rlk

fonksiyonlar yakla³k çözümün hem do§al hem de temel snr ³artlarnsa§laya ak

³ekilde seçilmelidir. A§rlkl kalan yöntemlerini ifadeetmek için

bölgesinde

A(u) = f

(1.3.1)

operatördenkleminigözönünealalm. Burada

A

lineerveyalineerolmayanbir ope-ratör,

u

ba§mlde§i³kenve

f

ba§mszde§i³keninbirfonksiyonuolaraktanmlanr. Buradaki

u

çözümüne, biryakla³m olarak

u

N

=

N

X

j=1

c

j

φ

j

+ φ

0

(1.3.2)

kullanlrve

(

1.3.1

)

denkleminde

(

1.3.2

)

ileverilen

u

N

yakla³kçözümyerine yazld-§nda

f

N

= A(u

N

)

fonksiyonueldeedilirkibu fonksiyongenellikle

f

'yee³itde§ildir.

(37)

A(u

N

)

ile

f

fonksiyonuarasndaki farka

R = A(u

N

) − f = A(

N

X

j=1

c

j

φ

j

+ φ

0

) − f 6= 0

(1.3.3)

yakla³mn kalan (rezidüsü) denir. Burada

R

kalan fonksiyonu

c

j

parametrelerine ba§l oldu§ukadar konumadaba§ldr. A§rlklkalan yöntemlerinde

c

j

parametre-leri

Z

ψ

i

(x, y)R(x, y, c

j

)dxdy = 0

(i = 1, 2, 3, ..., N)

(1.3.4)

a§rlklkalanintegralindeki

R

kalansfrola ak³ekildeseçilir. Burada

ikiboyutlu birbölgeve

ψ

i

'lerisea§rlklkalanfonksiyonlardr.

(

1.3.4

)

integralinin hesaplan-mas ile elde edilen denklemlerin çözülebilmesi için seçilen

ψ

i

a§rlkl kalan fonk-siyonlar kümesinin lineer ba§msz olmas gerekir. A§rlkl kalan yöntemlerinden

bazlar Galerkin, Petrov-Galerkin, Kollokasyonve Subdomain yöntemleridir [1℄.

1.3.1 Galerkin Yöntemi

Bu yöntemde

ψ

i

a§rlk fonksiyonlar

φ

i

yakla³m fonksiyonlaryla ayn seçilir. Galerkin yakla³mnn ebirsel denklemleri

N

X

j=1

A

ij

c

j

= F

i

(1.3.1.1)

³eklinde olup burada

A

ij

=

Z

φ

i

A(φ

j

)dxdy

F

i

=

Z

φ

i

[f − A(φ

0

)]dxdy

dir [1℄. 1.3.2 Petrov-Galerkin Yöntemi

ψ

i

6= φ

i

alnrsabu yöntem a§rlklkalanyöntemlerindenPetrov-Galerkin yön-temiolarakbilinir.

A

lineerbiroperatörolmaküzere

bölgesinde

(

1.3.4

)

yakla³m,

N

X

[

Z

ψ

i

A(φ

j

)dxdy]c

j

=

Z

ψ

i

[f − A(φ

0

)]dxdy

(38)

N

X

j=1

A

ij

c

j

= F

i

³eklindebasitbirformdayazlabilir. Buyöntemdeeldeedilen[

A

ij

℄katsaylarmatrisi simetrik de§ildir. Yani,

A

ij

=

Z

ψ

i

A(φ

j

)dxdy 6= A

ji

dir [1℄. 1.3.3 Kollokasyon Yöntemi

Kollokasyonyönteminde

çözüm bölgesinden seçilen

N

adet

x

i

≡ (x

i

, y

i

)

kol-lokasyonnoktasnda kalann sfrolmas istenir. Yani

R(x

i

, y

i

, c

j

) = 0

(i = 1, 2, ..., N)

olmaldr.

x

i

kollokasyon noktalarnn denklem sistemi iyi ³artl ola ak ³ekilde

seçilmesi önemlidir. Bu yöntemde

ψ

i

= δ(x − x

i

)

alnr ve

(1.3.4)

denkleminde yerine yazlrsa

Z

δ(x − x

i

)R(x, c

j

)dxdy = 0

veya

R(x

i

, c

j

) = 0

elde edilir. Burada

δ(x)

Dira delta fonksiyonudur ve

Z

f (x)δ(x − ξ)dxdy = f(ξ)

(39)

Bu yöntemde

ψ

i

a§rlkfonksiyonlar

ψ

i

=

1,

x

i

≤ x ≤ x

i+1

0,

digerdurumlar

i = 0, 1, . . . N

³eklinde seçilir. Altaralklarnsays

c

j

parametrelerininsaysnae³it ola ak ³ekilde belirlenmelidir[4℄.

ψ

i

a§rlkfonksiyonlar

(1.3.4)

denkleminde yazlrsa

Z

R(x, y, c

j

)dxdy = 0

(i = 0, 1, ..., N)

elde edilir. Bu denklem sistemininçözülmesi ile

c

j

parametrelerielde edilir.

1.4 Sonlu Elemanlar Yöntemi

Varyasyonelyöntemlerbirprobleminyakla³kçözümününbulunmasndaoldukça

kolay ve etkiliyöntemlerdir. An akbu yöntemlerde yakla³m fonksiyonlarnn

olu³-turulmas i³leminin zor olmas yöntemlerin etkinli§ini azaltmaktadr. Çünkü

yak-la³m fonksiyonlar sürekli, tam, lineer ba§msz ve ayn zamanda problemin temel

snr ³artlarn sa§lamaldr. Ayr a yakla³m fonksiyonlarn ürete ek sistematik

bir algoritma bulunmamaktadr. E§er problemin çözüm bölgesi karma³k ise

yak-la³m fonksiyonlarnbelirleme i³lemioldukçazor hatta bazen imkanszolmaktadr.

Varyasyonelyöntemlerinbudezavantajlarnortadankaldrmakiçinsonzamanlarda

sonlu elemanlaryöntemi daha sklkla kullanlrhale gelmi³tir [1℄.

Sonlu elemanlar yönteminin modern kullanm ilk olarak yapsal mühendislik

alannda ba³lam³tr. Bu alandaki ilk çal³malar gerçek ayrk elemanlar (çubuk ve

kiri³ler gibi)ilesürekliolan kat isminparçalararasndabenzerlikgeli³tiren

Hren-niko [5℄ ve M Henry tarafndan gerçekle³tirilmi³tir [6℄. Virtüel i³ prensibine

da-yal direkt bir yakla³m, Argyris tarafndan verilmi³ ve bir dizi makalede kendisi

ve meslekta³lar hesaplama tekniklerini kullanarak karma³k problemlerin çözümü

için bu çal³may geli³tirmi³lerdir[7℄. Sonlu eleman terimiilk olarak1960 ylnda

Clough tarafndan düzlemesnekli§indeki uygulamalartanmlad§makalesinde

(40)

uygulamal matematikçilerbu yöntem ile ilgiliartansayda çal³malaryapm³lardr

[9℄.

Sonluelemanlaryöntemi;yapmühendisli§i,yapmekani§i,ak³kanlar

meka-ni§i, uzay mühendisli§i,nükleerenerjimühendisli§i,biomekanikveelastik isimlerin

mekani§i,donanma mimarl§,dinamikvesiletimproblemlerigibide§i³ik

alanlar-daki problemlerekolaylklauygulanabilmektedir. Sonluelemanlaryönteminindi§er

yöntemlere göre avantajlar a³a§dakigibisralanabilir[2℄;

1. Düzensiz ³ekilli yaplar ve di§er yöntemlerle modellenemeyen farkl

karma³k bölgelerioldukça kolay bir³ekilde modelleyebilmesi,

2. Eleman denklemleri ayr ayr olu³turuldu§undan farkl malzemelerden

olu³an yaplar modelleyebilmesi,

3. Çok farkl snr ³artlar ile birlikte kullanlabilmesi. Snr ³artlarnn

de§i³mesi durumunda sonlu elemanmodelinin de§i³memesi,

4. Gerekti§inde elemanlarnbüyüklüklerininde§i³tirilebilmesi,

5. Sonlueleman modelininistenildi§izaman kolay ade§i³tirilebilmesi,

6. Bilgisayarprogramlamamant§na uygun olmas.

Sonluelemanlaryöntemininbu avantajlarnnyanndaçözümbölgesininalt

bölgelereayrlmasi³lemininbelirli birte rübeyi gerektirmesi, süreklilik³artlarnn

alt bölgelere uygulanmasndabirtakm zorluklarlakar³la³lmasve bilgisayar

prog-ramndaverigiri³israsndahatalaryaplmasgibibazdezavantajlardavardr. Bir

problemin sonlu eleman analizinde kullanlantemel admlar³unlardr [1℄:

1. Probleminçözüm bölgesininayrkla³trlmas (diskritizasyonu):

a. Ön eden belirlenenelemanlarn sonlu elemankümesi olu³turulur.

b. Elemanlarve dü§üm noktalarnumaralandrlr.

. Problem için gerekli olan geometrik özellikler (örne§in koordinatlar

ve kesit alanlargibi) üretilir.

2. Çözüm bölgesindeki bütün tipik elemanlar için eleman denklemlerinin

türetilmesi:

a. Tipik elemanlar üzerinde verilen diferansiyel denklemin varyasyonel

Şekil

Tablo 2.9: µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80 için Problem 1'in Uygulama 4 ile elde edilen saysal de§erleri.
Tablo 2.13: µ = 1, A = 0.25, ∆t = 0.05, 0 ≤ x ≤ 80 için Problem 1'in Uygulama 1 ile elde edilen saysal de§erleri.
Tablo 2.26: µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80 için Problem 1'in Uygulama 3 ile elde edilen saysal de§erleri.
Tablo 2.28: µ = 1, A = 0.25, h = 0.1, 0 ≤ x ≤ 80 için Problem 1'in Uygulama 4 ile elde edilen saysal de§erleri.
+7

Referanslar

Benzer Belgeler

Serum kortizol düzeyi için LC-MS/MS ve kemilüminesans immunoassay ile yapılan karşılaştırma çalışmasında elde ettiğimiz slope: 1.7, intercept:-0.40 olarak

nuclear weapons will strengthen Turkey's position vis- a-vis the aspiring nuclear states in the region and will also improve the pros- pects of a NWZ in the Middle East..

Etkin seçicilik yani hareket algısı, zeka içeren başka faaliyetlerde olduğu gibi görsel algının da temel bir özelliğidir ve dikkat edilmesi gereken en temel seçim de,

Tek hücre düzeni, en çok kullanılmış ve denenmiş bir iç mekan düzenidir. Geleneksel mekan tipinde mekan 1-5 kişilik odalardan oluşmaktadır. ) Hücresel büro mekanları

Bram Stoker’ın Dracula’sının, sinema ve televizyon dünyası için esin kaynağı olan temel anlatısı ve bu bağlamda orijinal romana büyük ölçüde sadık kalarak

ödülünü kazandırınca Tuncel Kurtiz, yabancı ülkelerde yaşayan Türk sanatçı kimliğinden çıkıp, uluslararası bir aktör olarak mesleğini sürdürmeye

Image annotation is categorized into two types as handcrafted and automatic image annotation (AIA), respectively. Handcrafted techniques, where image labels are given