• Sonuç bulunamadı

An asymptotic-numerical hybrid method for singularly perturbed system of two-point reaction-diffusion boundary-value problems

N/A
N/A
Info
İndir
Protected

Academic year: 2021

Share "An asymptotic-numerical hybrid method for singularly perturbed system of two-point reaction-diffusion boundary-value problems"

Copied!
13
0
0

Yükleniyor.... (view fulltext now)

Şimdi indir ( 13 sayfa )

Tam metin

Şekil

Figure 1. SCEM approximations to Example 4.1 for certain values of ε .
Table 2. Approximations to y 2 of Example 4.1 for various values of ε and N = 1024 . x y hybrid 2 for ε = 1 y hybrid2 for ε = 0.01 y 2 hybrid for ε = 0.0001
Figure 2. Errors in y 1 approximations of Example 4.1 for various values of ε .
Table 4. Approximations to y 3 of Example 4.2 for various values of ε , and N = 1024 .
+2

Referanslar

Şimdi indir ( PDF - 13 sayfa - 0.94 MB )

Benzer Belgeler

Modern-ulus devletin kuruluş ve gelişme sürecinde folklor, şiir ve fakelore

Bu çalışmada, Türk şiirinin modern-ulus devletin kuruluş ve gelişme dönemlerinde oynadığı rol ve uğra- dığı değişim süreci üzerinde durulmaktadır. Buna göre,

A suppressive oligodeoxynucleotide expressing TTAGGG motifs modulates cellular energetics through the mTOR signaling pathway

Of note, the transcriptome data revealed that the CpG ODN exerted an opposite effect on expressions of some mTOR-related genes, such as Stat3 and Myc ( Fig. 3 ), just as

First record of bomolochus bellones burmeister, 1833 (Copepoda: Bomolochidae) from Turkish marine habitats

– In this study, Bomolochus bellones Burmeister, 1833 (Copepoda: Bomolochi- dae) is reported for the first time on gill filaments and inside the operculum of Belone belone

Küçük molekül ağırlıklı sıçan idrar proteinlerinin karakterizasyonu

Spotların teorik α2u-globulin protein dizilerine göre eşleştirilmesi SPOT 1 GI:22219450 GI:204261 MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRV 59

Efficiency calibration and summation effects in gamma-ray spectrometry

Experimental coincidence summation effects were determined for various nuclides and compared with calculated values.. The results a~e found to be in good

Hamdullah Suphi Bey (Tanrıöver)

24 Mart 1931’de Mustafa Kemal Paşa'mn, Türk Ocaklarının Bilimsel Halkçılık ve Milliyetçilik ilkelerini yaymak görevi amacına ulaştığını ve CHP’nin bu

Can response variance effectively identify careless respondents to multi-item, unidimensional scales?

procedure which uses measures of response variance and cluster analysis to identify careless respondents was developed. The effectiveness of the procedure

Bedenin Gizli Silah›"Yanan Su" mu?

Araflt›rmac›lar, X-›fl›n› kristalogra- fisi uzamlar›n›n yard›m›yla çeflitli anti- korlar›n yap›s›n› incelediklerinde hep- si için ortak olan bölgelerinde